FAM160B2 anticorps (N-Term)

N° du produit ABIN632592

Détail du produit anti-FAM160B2 anticorps

Antigène: FAM160B2 (Family with Sequence Similarity 160, Member B2 (FAM160B2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM160B2 est non-conjugé

Application: Western Blotting (WB)

Specificité: RAI16 antibody was raised against the N terminal of RAI16

Purification: Affinity purified

Immunogène: RAI16 antibody was raised using the N terminal of RAI16 corresponding to a region with amino acids HYYIESTDESTPAKKTDIPWRLKQMLDILVYEEQQQAAAGEAGPCLEYLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAI16 Blocking Peptide, catalog no. 33R-3883, is also available for use as a blocking control in assays to test for specificity of this RAI16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAI16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM160B2

Antigène: FAM160B2 (Family with Sequence Similarity 160, Member B2 (FAM160B2))

Autre désignation: RAI16 (FAM160B2 Produits)

Synonymes: anticorps Rai16, anticorps RAI16, anticorps rai16, anticorps MGC146349, anticorps G430067P06Rik, anticorps zgc:153945, anticorps family with sequence similarity 160, member B2, anticorps family with sequence similarity 160 member B2, anticorps Fam160b2, anticorps FAM160B2, anticorps fam160b2

Sujet: The function of RAI16 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 82 kDa (MW of target protein)