RIBC1 anticorps (Middle Region)

N° du produit ABIN632596

Cet anticorps Lapin Polyclonal détecte spécifiquement RIBC1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour RIBC1 anticorps (Middle Region) (ABIN632596)

Antigène: RIBC1 (RIB43A Domain with Coiled-Coils 1 (RIBC1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RIBC1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RIBC1 anticorps

Épitope: Middle Region

Specificité: RIBC1 antibody was raised against the middle region of RIBC1

Purification: Affinity purified

Immunogène: RIBC1 antibody was raised using the middle region of RIBC1 corresponding to a region with amino acids ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RIBC1 Blocking Peptide, (ABIN936779), is also available for use as a blocking control in assays to test for specificity of this RIBC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIBC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RIBC1

Antigène: RIBC1 (RIB43A Domain with Coiled-Coils 1 (RIBC1))

Autre désignation: RIBC1

Sujet: The function of RIBC1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 44 kDa (MW of target protein)