LHPP anticorps (Middle Region)

N° du produit ABIN632600

Détail du produit anti-LHPP anticorps

Antigène: LHPP (Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase (LHPP))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LHPP est non-conjugé

Application: Western Blotting (WB)

Specificité: LHPP antibody was raised against the middle region of LHPP

Purification: Affinity purified

Immunogène: LHPP antibody was raised using the middle region of LHPP corresponding to a region with amino acids ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LHPP Blocking Peptide, catalog no. 33R-1067, is also available for use as a blocking control in assays to test for specificity of this LHPP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LHPP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LHPP

Antigène: LHPP (Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase (LHPP))

Autre désignation: LHPP (LHPP Produits)

Synonymes: anticorps HDHD2B, anticorps 2310007H09Rik, anticorps zgc:165670, anticorps phospholysine phosphohistidine inorganic pyrophosphate phosphatase, anticorps haloacid dehalogenase-like hydrolase domain-containing protein 2, anticorps phospholysine phosphohistidine inorganic pyrophosphate phosphatase S homeolog, anticorps LHPP, anticorps LB_102, anticorps PSPPH_2719, anticorps LOC5569494, anticorps CpipJ_CPIJ005727, anticorps Lhpp, anticorps lhpp.S, anticorps lhpp

Sujet: The function of LHPP protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 29 kDa (MW of target protein)