MAGEB4 anticorps (N-Term)

N° du produit ABIN632604

Détail du produit anti-MAGEB4 anticorps

Antigène: MAGEB4 (Melanoma Antigen Family B, 4 (MAGEB4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAGEB4 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAGEB4 antibody was raised against the N terminal of MAGEB4

Purification: Affinity purified

Immunogène: MAGEB4 antibody was raised using the N terminal of MAGEB4 corresponding to a region with amino acids KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAGEB4 Blocking Peptide, catalog no. 33R-4329, is also available for use as a blocking control in assays to test for specificity of this MAGEB4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAGEB4

Antigène: MAGEB4 (Melanoma Antigen Family B, 4 (MAGEB4))

Autre désignation: MAGEB4 (MAGEB4 Produits)

Synonymes: anticorps CT3.6, anticorps MAGEB4, anticorps MGC133739, anticorps CN716893, anticorps Mage-b4, anticorps mMage-b4, anticorps RGD1561997, anticorps MAGE family member B4, anticorps melanoma antigen family B, 4, anticorps melanoma antigen, family B, 4, anticorps MAGEB4, anticorps Mageb4

Sujet: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis.

Poids moléculaire: 39 kDa (MW of target protein)