GBP2 anticorps (N-Term)

N° du produit ABIN632613

Cet anticorps anti-GBP2 est un anticorps Lapin Polyclonal détectant GBP2 dans WB. Adapté pour Humain.

Aperçu rapide pour GBP2 anticorps (N-Term) (ABIN632613)

Antigène: GBP2 (Guanylate Binding Protein 2, Interferon-Inducible (GBP2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GBP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GBP2 anticorps

Épitope: N-Term

Specificité: GBP2 antibody was raised against the N terminal of GBP2

Purification: Affinity purified

Immunogène: GBP2 antibody was raised using the N terminal of GBP2 corresponding to a region with amino acids HYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GBP2 Blocking Peptide, (ABIN939267), is also available for use as a blocking control in assays to test for specificity of this GBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GBP2

Antigène: GBP2 (Guanylate Binding Protein 2, Interferon-Inducible (GBP2))

Autre désignation: GBP2

Sujet: GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). GBP2 is a GTPase that converts GTP to GDP and GMP.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin