Neurexophilin 4 anticorps (N-Term)

N° du produit ABIN632622

Détail du produit anti-Neurexophilin 4 anticorps

Antigène: Neurexophilin 4 (NXPH4)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Neurexophilin 4 est non-conjugé

Application: Western Blotting (WB)

Specificité: Neurexophilin 4 antibody was raised against the N terminal of NXPH4

Purification: Affinity purified

Immunogène: Neurexophilin 4 antibody was raised using the N terminal of NXPH4 corresponding to a region with amino acids MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Neurexophilin 4 Blocking Peptide, catalog no. 33R-6369, is also available for use as a blocking control in assays to test for specificity of this Neurexophilin 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXPH4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Neurexophilin 4

Antigène: Neurexophilin 4 (NXPH4)

Autre désignation: Neurexophilin 4 (NXPH4 Produits)

Synonymes: anticorps NXPH4, anticorps NPH4, anticorps 1110036M10Rik, anticorps AI851051, anticorps Nph4, anticorps neurexophilin 4, anticorps NXPH4, anticorps Nxph4

Sujet: NXPH4 may be signaling molecules that resemble neuropeptides and that act by binding to alpha-neurexins and possibly other receptors.

Poids moléculaire: 34 kDa (MW of target protein)