RPE anticorps (N-Term)

N° du produit ABIN632630

L’anticorps Lapin Polyclonal anti-RPE a été validé pour WB. Il convient pour détecter RPE dans des échantillons de Humain.

Aperçu rapide pour RPE anticorps (N-Term) (ABIN632630)

Antigène: RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPE est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPE anticorps

Épitope: N-Term

Specificité: RPE antibody was raised against the N terminal of RPE

Purification: Affinity purified

Immunogène: RPE antibody was raised using the N terminal of RPE corresponding to a region with amino acids ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPE Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this RPE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPE

Antigène: RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))

Autre désignation: RPE

Sujet: RPE is the enzyme that converts D-ribulose 5-phosphate into D-xylulose 5-phosphate in Calvin's reductive pentose phosphate cycle.

Poids moléculaire: 19 kDa (MW of target protein)