THNSL2 anticorps

N° du produit ABIN632635

Détail du produit anti-THNSL2 anticorps

Antigène: THNSL2 (threonine Synthase-Like 2 (THNSL2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp THNSL2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: THNSL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

THNSL2 Blocking Peptide, catalog no. 33R-5274, is also available for use as a blocking control in assays to test for specificity of this THNSL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THNSL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur THNSL2

Antigène: THNSL2 (threonine Synthase-Like 2 (THNSL2))

Autre désignation: THNSL2 (THNSL2 Produits)

Synonymes: anticorps BC051244, anticorps TSH2, anticorps SOFAT, anticorps THS2, anticorps RGD1309144, anticorps Tsh2, anticorps zgc:123281, anticorps threonine synthase-like 2 (bacterial), anticorps threonine synthase like 2, anticorps threonine synthase-like 2, anticorps Thnsl2, anticorps THNSL2, anticorps thnsl2

Sujet: THNSL2 dDegrades O-phospho-threonine (PThr) to alpha-ketobutyrate, ammonia and phosphate.

Poids moléculaire: 54 kDa (MW of target protein)