SAPS1 anticorps (N-Term)

N° du produit ABIN632640

Cet anticorps anti-SAPS1 est un anticorps Lapin Polyclonal détectant SAPS1 dans WB. Adapté pour Humain.

Aperçu rapide pour SAPS1 anticorps (N-Term) (ABIN632640)

Antigène: SAPS1 (SAPS Domain Family, Member 1 (SAPS1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SAPS1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SAPS1 anticorps

Épitope: N-Term

Specificité: PPP6 R1 antibody was raised against the N terminal of PPP6 1

Purification: Affinity purified

Immunogène: PPP6 R1 antibody was raised using the N terminal of PPP6 1 corresponding to a region with amino acids MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPP6R1 Blocking Peptide, (ABIN5615529), is also available for use as a blocking control in assays to test for specificity of this PPP6R1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SAPS1

Antigène: SAPS1 (SAPS Domain Family, Member 1 (SAPS1))

Autre désignation: PPP6R1

Sujet: Protein phosphatase regulatory subunits, such as SAPS1, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS1 is a regulatory subunit for the protein phosphatase-6 catalytic subunit.

Poids moléculaire: 97 kDa (MW of target protein)