SAPS1 anticorps (N-Term)

N° du produit ABIN632640

Détail du produit anti-SAPS1 anticorps

Antigène: SAPS1 (SAPS Domain Family, Member 1 (SAPS1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SAPS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PPP6 R1 antibody was raised against the N terminal of PPP6 1

Purification: Affinity purified

Immunogène: PPP6 R1 antibody was raised using the N terminal of PPP6 1 corresponding to a region with amino acids MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPP6R1 Blocking Peptide, catalog no. 33R-6008, is also available for use as a blocking control in assays to test for specificity of this PPP6R1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SAPS1

Antigène: SAPS1 (SAPS Domain Family, Member 1 (SAPS1))

Autre désignation: PPP6R1 (SAPS1 Produits)

Synonymes: anticorps KIAA1115, anticorps PP6R1, anticorps SAP190, anticorps SAPS1, anticorps 2010309P17Rik, anticorps AI836219, anticorps B430201G11Rik, anticorps D030074N20Rik, anticorps Pp6r1, anticorps Saps1, anticorps mKIAA1115, anticorps RGD1311409, anticorps pp6r1, anticorps MGC69001, anticorps protein phosphatase 6 regulatory subunit 1, anticorps protein phosphatase 6, regulatory subunit 1, anticorps protein phosphatase 6 regulatory subunit 1 L homeolog, anticorps PPP6R1, anticorps Ppp6r1, anticorps ppp6r1.L

Sujet: Protein phosphatase regulatory subunits, such as SAPS1, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS1 is a regulatory subunit for the protein phosphatase-6 catalytic subunit.

Poids moléculaire: 97 kDa (MW of target protein)