GPALPP1 anticorps (Middle Region)

N° du produit ABIN632646

Cet anticorps anti-GPALPP1 est un anticorps Lapin Polyclonal détectant GPALPP1 dans WB. Adapté pour Humain.

Aperçu rapide pour GPALPP1 anticorps (Middle Region) (ABIN632646)

Antigène: GPALPP1 (GPALPP Motifs Containing 1 (GPALPP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPALPP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GPALPP1 anticorps

Épitope: Middle Region

Specificité: KIAA1704 antibody was raised against the middle region of KIAA1704

Purification: Affinity purified

Immunogène: KIAA1704 antibody was raised using the middle region of KIAA1704 corresponding to a region with amino acids KAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA1704 Blocking Peptide, (ABIN939618), is also available for use as a blocking control in assays to test for specificity of this KIAA1704 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1704 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPALPP1

Antigène: GPALPP1 (GPALPP Motifs Containing 1 (GPALPP1))

Autre désignation: KIAA1704

Sujet: The function of KIAA1704 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 38 kDa (MW of target protein)