GPALPP1 anticorps (Middle Region)

N° du produit ABIN632646

Détail du produit anti-GPALPP1 anticorps

Antigène: GPALPP1 (GPALPP Motifs Containing 1 (GPALPP1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPALPP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIAA1704 antibody was raised against the middle region of KIAA1704

Purification: Affinity purified

Immunogène: KIAA1704 antibody was raised using the middle region of KIAA1704 corresponding to a region with amino acids KAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA1704 Blocking Peptide, catalog no. 33R-4232, is also available for use as a blocking control in assays to test for specificity of this KIAA1704 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1704 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPALPP1

Antigène: GPALPP1 (GPALPP Motifs Containing 1 (GPALPP1))

Autre désignation: KIAA1704 (GPALPP1 Produits)

Synonymes: anticorps KIAA1704, anticorps LSR7, anticorps RP11-245H20.2, anticorps bA245H20.2, anticorps 1200011I18Rik, anticorps Kiaa1704, anticorps fc50h08, anticorps wu:fc50h08, anticorps zgc:91844, anticorps GPALPP motifs containing 1, anticorps GPALPP1, anticorps Gpalpp1, anticorps gpalpp1

Sujet: The function of KIAA1704 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 38 kDa (MW of target protein)