GAN anticorps (Middle Region)

N° du produit ABIN632648

Détail du produit anti-GAN anticorps

Antigène: GAN (Gigaxonin (GAN))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GAN est non-conjugé

Application: Western Blotting (WB)

Specificité: GAN antibody was raised against the middle region of GAN

Purification: Affinity purified

Immunogène: GAN antibody was raised using the middle region of GAN corresponding to a region with amino acids IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GAN Blocking Peptide, catalog no. 33R-4223, is also available for use as a blocking control in assays to test for specificity of this GAN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GAN

Antigène: GAN (Gigaxonin (GAN))

Autre désignation: GAN (GAN Produits)

Synonymes: anticorps MGC81691, anticorps GAN, anticorps A330045G18, anticorps gigaxonin, anticorps GAN1, anticorps KLHL16, anticorps gigaxonin L homeolog, anticorps gigaxonin, anticorps giant axonal neuropathy, anticorps gan.L, anticorps gan, anticorps GAN, anticorps Gan

Sujet: This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN).

Poids moléculaire: 66 kDa (MW of target protein)