FAM160B1 anticorps (N-Term)

N° du produit ABIN632652

Cet anticorps anti-FAM160B1 est un anticorps Lapin Polyclonal détectant FAM160B1 dans WB. Adapté pour Humain.

Aperçu rapide pour FAM160B1 anticorps (N-Term) (ABIN632652)

Antigène: FAM160B1 (Family with Sequence Similarity 160, Member B1 (FAM160B1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM160B1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM160B1 anticorps

Épitope: N-Term

Specificité: FAM160 B1 antibody was raised against the N terminal of FAM160 1

Purification: Affinity purified

Immunogène: FAM160 B1 antibody was raised using the N terminal of FAM160 1 corresponding to a region with amino acids HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM160B1 Blocking Peptide, (ABIN939270), is also available for use as a blocking control in assays to test for specificity of this FAM160B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM160 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM160B1

Antigène: FAM160B1 (Family with Sequence Similarity 160, Member B1 (FAM160B1))

Autre désignation: FAM160B1

Sujet: The function of FAM160 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 86 kDa (MW of target protein)