DCMP Deaminase (DCTD) (Middle Region) anticorps

N° du produit ABIN632656

Cet anticorps Lapin Polyclonal détecte spécifiquement DCMP Deaminase dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour DCMP Deaminase (DCTD) (Middle Region) anticorps (ABIN632656)

Antigène: DCMP Deaminase (DCTD)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: Middle Region

Specificité: DCTD antibody was raised against the middle region of DCTD

Purification: Affinity purified

Immunogène: DCTD antibody was raised using the middle region of DCTD corresponding to a region with amino acids MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DCTD Blocking Peptide, (ABIN5613141), is also available for use as a blocking control in assays to test for specificity of this DCTD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCTD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: DCMP Deaminase (DCTD)

Autre désignation: DCTD

Sujet: The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 21 kDa (MW of target protein)