DCMP Deaminase (DCTD) (Middle Region) anticorps

N° du produit ABIN632656

Détail du produit

Antigène: DCMP Deaminase (DCTD)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: DCTD antibody was raised against the middle region of DCTD

Purification: Affinity purified

Immunogène: DCTD antibody was raised using the middle region of DCTD corresponding to a region with amino acids MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DCTD Blocking Peptide, catalog no. 33R-6407, is also available for use as a blocking control in assays to test for specificity of this DCTD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCTD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: DCMP Deaminase (DCTD)

Autre désignation: DCTD (DCTD Produits)

Synonymes: anticorps zgc:110226, anticorps DCTD, anticorps 6030466N05Rik, anticorps Afu2g06240, anticorps MGC81193, anticorps dCMP deaminase, anticorps deoxycytidylate deaminase, anticorps cell division protein DedD, anticorps dCMP deaminase L homeolog, anticorps conserved uncharacterised protein, anticorps DCTD, anticorps dctd, anticorps dctD, anticorps Dctd, anticorps AFUA_2G06240, anticorps ACLA_068070, anticorps LELG_03636, anticorps VIBHAR_RS20285, anticorps LOC5564022, anticorps Ccur_00700, anticorps PAAG_00286, anticorps SPAP_0719, anticorps LOC100285892, anticorps dctd.L, anticorps CNB00950, anticorps THAPS_42740, anticorps dCMP deaminase, anticorps Thena_0587, anticorps Ccan_15560

Classe de substances: Viral Protein

Sujet: The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 21 kDa (MW of target protein)