CHMP1B anticorps (N-Term)

N° du produit ABIN632659

Détail du produit anti-CHMP1B anticorps

Antigène: CHMP1B (Charged Multivesicular Body Protein 1B (CHMP1B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHMP1B est non-conjugé

Application: Western Blotting (WB)

Specificité: CHMP1 B antibody was raised against the N terminal of CHMP1

Purification: Affinity purified

Immunogène: CHMP1 B antibody was raised using the N terminal of CHMP1 corresponding to a region with amino acids KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHMP1B Blocking Peptide, catalog no. 33R-4435, is also available for use as a blocking control in assays to test for specificity of this CHMP1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHMP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHMP1B

Antigène: CHMP1B (Charged Multivesicular Body Protein 1B (CHMP1B))

Autre désignation: CHMP1B (CHMP1B Produits)

Synonymes: anticorps C10orf2, anticorps C18-ORF2, anticorps C18orf2, anticorps CHMP1.5, anticorps Vps46-2, anticorps Vps46B, anticorps hVps46-2, anticorps 2810405I11Rik, anticorps Chmp1b1, anticorps Chmp1.5, anticorps fb10c03, anticorps wu:fb10c03, anticorps zgc:56134, anticorps chromatin modifying protein 1b, anticorps hypothetical protein, anticorps charged multivesicular body protein 1B, anticorps chromatin modifying protein 1B, anticorps LOC692931, anticorps PGTG_18215, anticorps CHMP1B, anticorps Chmp1b, anticorps chmp1b

Sujet: CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A, is required for both MVB formation and regulation of cell cycle progression.

Poids moléculaire: 22 kDa (MW of target protein)