CDC27 anticorps

N° du produit ABIN632660

Détail du produit anti-CDC27 anticorps

Antigène: CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDC27 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CDC27 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDC27 Blocking Peptide, catalog no. 33R-4514, is also available for use as a blocking control in assays to test for specificity of this CDC27 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC27 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDC27

Antigène: CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))

Autre désignation: CDC27 (CDC27 Produits)

Synonymes: anticorps ANAPC3, anticorps APC3, anticorps CDC27Hs, anticorps D0S1430E, anticorps D17S978E, anticorps HNUC, anticorps NUC2, anticorps wu:fb54g06, anticorps wu:fc88c12, anticorps AI452358, anticorps BC023187, anticorps CDC27, anticorps NV10210, anticorps cell division cycle 27, anticorps cell division cycle 27 S homeolog, anticorps cell division cycle protein 27 homolog, anticorps anaphase-promoting complex subunit Apc3, anticorps CDC27, anticorps cdc27, anticorps Cdc27, anticorps cdc27.S, anticorps LOC100123129, anticorps nuc2

Sujet: The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells.

Poids moléculaire: 92 kDa (MW of target protein)