CDC27 anticorps

N° du produit ABIN632660

L’anticorps anti-CDC27 Polyclonal Lapin est utilisé pour la détection de CDC27 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour CDC27 anticorps (ABIN632660)

Antigène: CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDC27 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CDC27 anticorps

Purification: Affinity purified

Immunogène: CDC27 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDC27 Blocking Peptide, (ABIN939900), is also available for use as a blocking control in assays to test for specificity of this CDC27 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC27 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDC27

Antigène: CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))

Autre désignation: CDC27

Sujet: The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells.

Poids moléculaire: 92 kDa (MW of target protein)