HOMER1 anticorps

N° du produit ABIN632669

L’anticorps Lapin Polyclonal anti-HOMER1 a été validé pour WB. Il convient pour détecter HOMER1 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour HOMER1 anticorps (ABIN632669)

Antigène: HOMER1 (Homer Homolog 1 (HOMER1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HOMER1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HOMER1 anticorps

Purification: Affinity purified

Immunogène: HOMER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD

Information d'application

Indications d'application: WB: 0.0156 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HOMER1 Blocking Peptide, (ABIN937888), is also available for use as a blocking control in assays to test for specificity of this HOMER1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HOMER1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HOMER1

Antigène: HOMER1 (Homer Homolog 1 (HOMER1))

Autre désignation: HOMER1

Sujet: HOMER1 is a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development