UGP2 anticorps (N-Term)

N° du produit ABIN632677

Détail du produit anti-UGP2 anticorps

Antigène: UGP2 (UDP-Glucose Pyrophosphorylase 2 (UGP2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: UGP2 antibody was raised against the N terminal of µgP2

Purification: Affinity purified

Immunogène: UGP2 antibody was raised using the N terminal of µgP2 corresponding to a region with amino acids TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGP2 Blocking Peptide, catalog no. 33R-9141, is also available for use as a blocking control in assays to test for specificity of this µgP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGP2

Antigène: UGP2 (UDP-Glucose Pyrophosphorylase 2 (UGP2))

Autre désignation: UGP2 (UGP2 Produits)

Synonymes: anticorps DDBDRAFT_0204359, anticorps DDBDRAFT_0214911, anticorps DDB_0204359, anticorps DDB_0214911, anticorps UDPG, anticorps UDPGP, anticorps UDPGP2, anticorps UGP1, anticorps UGPP1, anticorps UGPP2, anticorps pHC379, anticorps Ugp2, anticorps fi53h10, anticorps wu:fi53h10, anticorps zgc:85662, anticorps AtUGP1, anticorps T17B22.6, anticorps T17B22_6, anticorps UDP-GLUCOSE PYROPHOSPHORYLASE 1, anticorps UDP-glucose pyrophosphorylase, anticorps UGP, anticorps UGPASE, anticorps UGPase, anticorps UDP-glucose pyrophosphorylase 2, anticorps UDP-glucose pyrophosphorylase 2 L homeolog, anticorps UDP-glucose pyrophosphorylase 2b, anticorps UDP-GLUCOSE PYROPHOSPHORYLASE 1, anticorps UDP-glucose pyrophosphorylase precursor, anticorps ugpB, anticorps ugp2.L, anticorps UGP2, anticorps Ugp2, anticorps ugp2b, anticorps LOAG_08596, anticorps DICPUDRAFT_55932, anticorps UGP1, anticorps LOC102577726

Sujet: UGP2 is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen, in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process