TRUB2 anticorps (N-Term)

N° du produit ABIN632678

L’anticorps Lapin Polyclonal anti-TRUB2 a été validé pour WB. Il convient pour détecter TRUB2 dans des échantillons de Humain.

Aperçu rapide pour TRUB2 anticorps (N-Term) (ABIN632678)

Antigène: TRUB2 (TruB Pseudouridine (Psi) Synthase Homolog 2 (TRUB2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRUB2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TRUB2 anticorps

Épitope: N-Term

Specificité: TRUB2 antibody was raised against the N terminal of TRUB2

Purification: Affinity purified

Immunogène: TRUB2 antibody was raised using the N terminal of TRUB2 corresponding to a region with amino acids MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRUB2 Blocking Peptide, (ABIN5616821), is also available for use as a blocking control in assays to test for specificity of this TRUB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRUB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRUB2

Antigène: TRUB2 (TruB Pseudouridine (Psi) Synthase Homolog 2 (TRUB2))

Autre désignation: TRUB2

Sujet: Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase.Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase.

Poids moléculaire: 37 kDa (MW of target protein)