PM20D2 anticorps (Middle Region)

N° du produit ABIN632689

Cet anticorps Lapin Polyclonal détecte spécifiquement PM20D2 dans WB. Il présente une réactivité avec des échantillons de Humain et Rat.

Aperçu rapide pour PM20D2 anticorps (Middle Region) (ABIN632689)

Antigène: PM20D2 (Peptidase M20 Domain Containing 2 (PM20D2))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PM20D2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PM20D2 anticorps

Épitope: Middle Region

Specificité: PM20 D2 antibody was raised against the middle region of PM20 2

Purification: Affinity purified

Immunogène: PM20 D2 antibody was raised using the middle region of PM20 2 corresponding to a region with amino acids HGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALAS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PM20D2 Blocking Peptide, (ABIN939124), is also available for use as a blocking control in assays to test for specificity of this PM20D2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PM20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PM20D2

Antigène: PM20D2 (Peptidase M20 Domain Containing 2 (PM20D2))

Autre désignation: PM20D2

Sujet: PM20D2 belongs to the peptidase M20A family. The function of PM20D2 remains unknown.

Poids moléculaire: 48 kDa (MW of target protein)