PM20D2 anticorps (Middle Region)

N° du produit ABIN632689

Détail du produit anti-PM20D2 anticorps

Antigène: PM20D2 (Peptidase M20 Domain Containing 2 (PM20D2))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PM20D2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PM20 D2 antibody was raised against the middle region of PM20 2

Purification: Affinity purified

Immunogène: PM20 D2 antibody was raised using the middle region of PM20 2 corresponding to a region with amino acids HGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALAS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PM20D2 Blocking Peptide, catalog no. 33R-3738, is also available for use as a blocking control in assays to test for specificity of this PM20D2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PM20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PM20D2

Antigène: PM20D2 (Peptidase M20 Domain Containing 2 (PM20D2))

Autre désignation: PM20D2 (PM20D2 Produits)

Synonymes: anticorps ACY1L2, anticorps bA63L7.3, anticorps Acy1l2, anticorps Gm424, anticorps peptidase M20 domain containing 2, anticorps PM20D2, anticorps Pm20d2

Sujet: PM20D2 belongs to the peptidase M20A family. The function of PM20D2 remains unknown.

Poids moléculaire: 48 kDa (MW of target protein)