FAM78B anticorps (Middle Region)

N° du produit ABIN632691

Cet anticorps anti-FAM78B est un anticorps Lapin Polyclonal détectant FAM78B dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour FAM78B anticorps (Middle Region) (ABIN632691)

Antigène: FAM78B (Family with Sequence Similarity 78, Member B (FAM78B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM78B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM78B anticorps

Épitope: Middle Region

Specificité: FAM78 B antibody was raised against the middle region of FAM78

Purification: Affinity purified

Immunogène: FAM78 B antibody was raised using the middle region of FAM78 corresponding to a region with amino acids PSVTWAVPVSDSNVPLLTRIKRDQSFTTWLVAMNTTTKEKIILQTIKWRM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM78B Blocking Peptide, (ABIN5613504), is also available for use as a blocking control in assays to test for specificity of this FAM78B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM78B

Antigène: FAM78B (Family with Sequence Similarity 78, Member B (FAM78B))

Autre désignation: FAM78B

Sujet: The function of FAM78B protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 30 kDa (MW of target protein)