DPH1 anticorps

N° du produit ABIN632695

Détail du produit anti-DPH1 anticorps

Antigène: DPH1 (DPH1 Homolog (DPH1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPH1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPH1 Blocking Peptide, catalog no. 33R-8068, is also available for use as a blocking control in assays to test for specificity of this DPH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPH1

Antigène: DPH1 (DPH1 Homolog (DPH1))

Autre désignation: DPH1 (DPH1 Produits)

Synonymes: anticorps DPH1, anticorps DPH1-OVCA2, anticorps dph1-ovca2, anticorps dph2l, anticorps dph2l1, anticorps ovca1, anticorps DPH2L, anticorps DPH2L1, anticorps OVCA1, anticorps zgc:110702, anticorps 2310011M22Rik, anticorps 4930488F09Rik, anticorps AW551873, anticorps Dph2l1, anticorps Ovca1, anticorps RGD1562694, anticorps diphthamide biosynthesis 1, anticorps diphthamide biosynthesis protein 1, anticorps diphthamide biosynthesis 1 L homeolog, anticorps 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1, anticorps DPH1, anticorps NCU08503, anticorps ATEG_01183, anticorps LELG_00973, anticorps HCAG_03806, anticorps AOR_1_728014, anticorps PTRG_05729, anticorps CTRG_01524, anticorps UREG_06411, anticorps BDBG_05574, anticorps MCYG_04396, anticorps PITG_12187, anticorps MGYG_02224, anticorps LOC100284663, anticorps dph1.L, anticorps dph1, anticorps Dph1, anticorps dph-1

Sujet: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.

Poids moléculaire: 49 kDa (MW of target protein)