LRRC42 anticorps (N-Term)

N° du produit ABIN632704

Cet anticorps Lapin Polyclonal détecte spécifiquement LRRC42 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour LRRC42 anticorps (N-Term) (ABIN632704)

Antigène: LRRC42 (Leucine Rich Repeat Containing 42 (LRRC42))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC42 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LRRC42 anticorps

Épitope: N-Term

Specificité: LRRC42 antibody was raised against the N terminal of LRRC42

Purification: Affinity purified

Immunogène: LRRC42 antibody was raised using the N terminal of LRRC42 corresponding to a region with amino acids LIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC42 Blocking Peptide, (ABIN940429), is also available for use as a blocking control in assays to test for specificity of this LRRC42 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC42

Antigène: LRRC42 (Leucine Rich Repeat Containing 42 (LRRC42))

Autre désignation: LRRC42

Sujet: The function of LRRC42 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 48 kDa (MW of target protein)