C20orf160 anticorps (N-Term)

N° du produit ABIN632706

Détail du produit anti-C20orf160 anticorps

Antigène: C20orf160 (Chromosome 20 Open Reading Frame 160 (C20orf160))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C20orf160 est non-conjugé

Application: Western Blotting (WB)

Specificité: C20 ORF160 antibody was raised against the N terminal Of C20 rf160

Purification: Affinity purified

Immunogène: C20 ORF160 antibody was raised using the N terminal Of C20 rf160 corresponding to a region with amino acids LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C20ORF160 Blocking Peptide, catalog no. 33R-5492, is also available for use as a blocking control in assays to test for specificity of this C20ORF160 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF160 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C20orf160

Antigène: C20orf160 (Chromosome 20 Open Reading Frame 160 (C20orf160))

Autre désignation: C20ORF160 (C20orf160 Produits)

Synonymes: anticorps C20orf160, anticorps dJ310O13.5, anticorps C20H20orf160, anticorps CCM2 like scaffolding protein, anticorps cerebral cavernous malformation 2-like, anticorps CCM2L, anticorps Ccm2l

Sujet: The specific function of C20orf160 is not yet known.

Poids moléculaire: 47 kDa (MW of target protein)