Sialidase 4 anticorps (N-Term)

N° du produit ABIN632708

L’anticorps Lapin Polyclonal anti-Sialidase 4 a été validé pour WB. Il convient pour détecter Sialidase 4 dans des échantillons de Humain et Souris.

Aperçu rapide pour Sialidase 4 anticorps (N-Term) (ABIN632708)

Antigène: Sialidase 4 (NEU4)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sialidase 4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Sialidase 4 anticorps

Épitope: N-Term

Specificité: NEU4 antibody was raised against the N terminal of NEU4

Purification: Affinity purified

Immunogène: NEU4 antibody was raised using the N terminal of NEU4 corresponding to a region with amino acids TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NEU4 Blocking Peptide, (ABIN5614962), is also available for use as a blocking control in assays to test for specificity of this NEU4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEU4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Sialidase 4

Antigène: Sialidase 4 (NEU4)

Autre désignation: NEU4

Sujet: NEU4 belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids.

Poids moléculaire: 53 kDa (MW of target protein)