ACOT12 anticorps (Middle Region)

N° du produit ABIN632711

L’anticorps Lapin Polyclonal anti-ACOT12 a été validé pour WB. Il convient pour détecter ACOT12 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ACOT12 anticorps (Middle Region) (ABIN632711)

Antigène: ACOT12 (Acyl-CoA Thioesterase 12 (ACOT12))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACOT12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACOT12 anticorps

Épitope: Middle Region

Specificité: ACOT12 antibody was raised against the middle region of ACOT12

Purification: Affinity purified

Immunogène: ACOT12 antibody was raised using the middle region of ACOT12 corresponding to a region with amino acids SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACOT12 Blocking Peptide, (ABIN5611906), is also available for use as a blocking control in assays to test for specificity of this ACOT12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACOT12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACOT12

Antigène: ACOT12 (Acyl-CoA Thioesterase 12 (ACOT12))

Autre désignation: ACOT12

Sujet: ACOT12 contains 2 acyl coenzyme A hydrolase domains and 1 START domain. It hydrolyzes acetyl-CoA to acetate and CoA.

Poids moléculaire: 62 kDa (MW of target protein)