ACOT12 anticorps (Middle Region)

N° du produit ABIN632711

Détail du produit anti-ACOT12 anticorps

Antigène: ACOT12 (Acyl-CoA Thioesterase 12 (ACOT12))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACOT12 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACOT12 antibody was raised against the middle region of ACOT12

Purification: Affinity purified

Immunogène: ACOT12 antibody was raised using the middle region of ACOT12 corresponding to a region with amino acids SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACOT12 Blocking Peptide, catalog no. 33R-8317, is also available for use as a blocking control in assays to test for specificity of this ACOT12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACOT12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACOT12

Antigène: ACOT12 (Acyl-CoA Thioesterase 12 (ACOT12))

Autre désignation: ACOT12 (ACOT12 Produits)

Synonymes: anticorps MGC189641, anticorps CACH-1, anticorps Cach, anticorps STARD15, anticorps THEAL, anticorps 1300004O04Rik, anticorps 4930449F15Rik, anticorps AV027244, anticorps mCACH-1, anticorps rACH, anticorps acyl-CoA thioesterase 12, anticorps acyl-CoA thioesterase 12 L homeolog, anticorps ACOT12, anticorps acot12, anticorps acot12.L, anticorps Acot12

Sujet: ACOT12 contains 2 acyl coenzyme A hydrolase domains and 1 START domain. It hydrolyzes acetyl-CoA to acetate and CoA.

Poids moléculaire: 62 kDa (MW of target protein)