DYDC1 anticorps (Middle Region)

N° du produit ABIN632723

L’anticorps Lapin Polyclonal anti-DYDC1 a été validé pour WB. Il convient pour détecter DYDC1 dans des échantillons de Humain, Rat et Souris.

Aperçu rapide pour DYDC1 anticorps (Middle Region) (ABIN632723)

Antigène: DYDC1 (DPY30 Domain Containing 1 (DYDC1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DYDC1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DYDC1 anticorps

Épitope: Middle Region

Specificité: DYDC1 antibody was raised against the middle region of DYDC1

Purification: Affinity purified

Immunogène: DYDC1 antibody was raised using the middle region of DYDC1 corresponding to a region with amino acids EDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DYDC1 Blocking Peptide, (ABIN937701), is also available for use as a blocking control in assays to test for specificity of this DYDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DYDC1

Antigène: DYDC1 (DPY30 Domain Containing 1 (DYDC1))

Autre désignation: DYDC1

Sujet: DYDC1 plays a crucial role during acrosome biogenesis.

Poids moléculaire: 21 kDa (MW of target protein)