DYDC1 anticorps (Middle Region)

N° du produit ABIN632723

Détail du produit anti-DYDC1 anticorps

Antigène: DYDC1 (DPY30 Domain Containing 1 (DYDC1))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DYDC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DYDC1 antibody was raised against the middle region of DYDC1

Purification: Affinity purified

Immunogène: DYDC1 antibody was raised using the middle region of DYDC1 corresponding to a region with amino acids EDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DYDC1 Blocking Peptide, catalog no. 33R-2315, is also available for use as a blocking control in assays to test for specificity of this DYDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DYDC1

Antigène: DYDC1 (DPY30 Domain Containing 1 (DYDC1))

Autre désignation: DYDC1 (DYDC1 Produits)

Synonymes: anticorps DPY30D1, anticorps 1700029M23Rik, anticorps DPY30 domain containing 1, anticorps DPY30 domain containing 1 L homeolog, anticorps DYDC1, anticorps dydc1.L, anticorps Dydc1

Sujet: DYDC1 plays a crucial role during acrosome biogenesis.

Poids moléculaire: 21 kDa (MW of target protein)