PACRGL anticorps (Middle Region)

N° du produit ABIN632727

Cet anticorps anti-PACRGL est un anticorps Lapin Polyclonal détectant PACRGL dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour PACRGL anticorps (Middle Region) (ABIN632727)

Antigène: PACRGL (PARK2 Co-Regulated-Like (PACRGL))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PACRGL est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PACRGL anticorps

Épitope: Middle Region

Specificité: C4 ORF28 antibody was raised against the middle region of C4 rf28

Purification: Affinity purified

Immunogène: C4 ORF28 antibody was raised using the middle region of C4 rf28 corresponding to a region with amino acids PPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C4ORF28 Blocking Peptide, (ABIN5612521), is also available for use as a blocking control in assays to test for specificity of this C4ORF28 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PACRGL

Antigène: PACRGL (PARK2 Co-Regulated-Like (PACRGL))

Autre désignation: C4ORF28

Sujet: The function of Chromosome 4 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 24 kDa (MW of target protein)