WDR63 anticorps (Middle Region)

N° du produit ABIN632728

Détail du produit anti-WDR63 anticorps

Antigène: WDR63 (WD Repeat Domain 63 (WDR63))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR63 est non-conjugé

Application: Western Blotting (WB)

Specificité: WDR63 antibody was raised against the middle region of WDR63

Purification: Affinity purified

Immunogène: WDR63 antibody was raised using the middle region of WDR63 corresponding to a region with amino acids EIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR63 Blocking Peptide, catalog no. 33R-2463, is also available for use as a blocking control in assays to test for specificity of this WDR63 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR63 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR63

Antigène: WDR63 (WD Repeat Domain 63 (WDR63))

Autre désignation: WDR63 (WDR63 Produits)

Synonymes: anticorps DIC3, anticorps NYD-SP29, anticorps RP11-507C22.2, anticorps 4931433A13Rik, anticorps RGD1563105, anticorps WD repeat domain 63, anticorps WDR63, anticorps Wdr63

Sujet: WDR63 contains 5 WD repeats. The exact function of WDR63 is not known.

Poids moléculaire: 103 kDa (MW of target protein)