LSM12B anticorps

N° du produit ABIN632732

L’anticorps Lapin Polyclonal anti-LSM12B a été validé pour WB. Il convient pour détecter LSM12B dans des échantillons de Souris, Rat et Humain.

Aperçu rapide pour LSM12B anticorps (ABIN632732)

Antigène: LSM12B (LSM12 Homolog B (LSM12B))

Reactivité: Souris, Rat, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LSM12B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LSM12B anticorps

Purification: Affinity purified

Immunogène: LSM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LSM12 Blocking Peptide, (ABIN5614596), is also available for use as a blocking control in assays to test for specificity of this LSM12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LSM12B

Antigène: LSM12B (LSM12 Homolog B (LSM12B))

Autre désignation: LSM12

Sujet: LSM12 belongs to the LSM12 family. The exact function of LSM12 is not known.

Poids moléculaire: 22 kDa (MW of target protein)