AMDHD1 anticorps (N-Term)

N° du produit ABIN632735

L’anticorps anti-AMDHD1 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de AMDHD1 dans des échantillons provenant de Humain. }

Aperçu rapide pour AMDHD1 anticorps (N-Term) (ABIN632735)

Antigène: AMDHD1 (Amidohydrolase Domain Containing 1 (AMDHD1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AMDHD1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AMDHD1 anticorps

Épitope: N-Term

Specificité: AMDHD1 antibody was raised against the N terminal of AMDHD1

Purification: Affinity purified

Immunogène: AMDHD1 antibody was raised using the N terminal of AMDHD1 corresponding to a region with amino acids AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AMDHD1 Blocking Peptide, (ABIN936990), is also available for use as a blocking control in assays to test for specificity of this AMDHD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMDHD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AMDHD1

Antigène: AMDHD1 (Amidohydrolase Domain Containing 1 (AMDHD1))

Autre désignation: AMDHD1

Sujet: The function of AMDHD protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 47 kDa (MW of target protein)