Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

Methyltransferase Like 19 (METTL19) (N-Term) anticorps Primary Antibody

METTL19 Reactivité: Humain, Rat WB Hôte: Lapin Polyclonal
N° du produit ABIN632740
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Destination: Etats-Unis
Envoi sous 9 à 11 jours ouvrables
  • Antigène
    Épitope
    N-Term
    Reactivité
    Humain, Rat
    Hôte
    Lapin
    Clonalité
    Polyclonal
    Application
    Western Blotting (WB)
    Specificité
    C4 ORF23 antibody was raised against the N terminal Of C4 rf23
    Purification
    Affinity purified
    Immunogène
    C4 ORF23 antibody was raised using the N terminal Of C4 rf23 corresponding to a region with amino acids LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIK
  • Indications d'application
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    C4ORF23 Blocking Peptide, catalog no. 33R-5486, is also available for use as a blocking control in assays to test for specificity of this C4ORF23 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF23 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Stock
    4 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Antigène
    Autre désignation
    C4ORF23 (METTL19 Antibody Extrait)
    Sujet
    The function of Chromosome 4 ORF protein is not widely studied, and is yet to be elucidated fully.
    Poids moléculaire
    41 kDa (MW of target protein)
Vous êtes ici: