FAM76A anticorps (N-Term)

N° du produit ABIN632747

L’anticorps Lapin Polyclonal anti-FAM76A a été validé pour WB. Il convient pour détecter FAM76A dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour FAM76A anticorps (N-Term) (ABIN632747)

Antigène: FAM76A (Family with Sequence Similarity 76, Member A (FAM76A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM76A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM76A anticorps

Épitope: N-Term

Specificité: FAM76 A antibody was raised against the N terminal of FAM76

Purification: Affinity purified

Immunogène: FAM76 A antibody was raised using the N terminal of FAM76 corresponding to a region with amino acids MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM76A Blocking Peptide, (ABIN5613500), is also available for use as a blocking control in assays to test for specificity of this FAM76A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM76A

Antigène: FAM76A (Family with Sequence Similarity 76, Member A (FAM76A))

Autre désignation: FAM76A

Sujet: The specific function of FAM76A is not yet known.

Poids moléculaire: 35 kDa (MW of target protein)