FAM76A anticorps (N-Term)

N° du produit ABIN632747

Détail du produit anti-FAM76A anticorps

Antigène: FAM76A (Family with Sequence Similarity 76, Member A (FAM76A))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM76A est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM76 A antibody was raised against the N terminal of FAM76

Purification: Affinity purified

Immunogène: FAM76 A antibody was raised using the N terminal of FAM76 corresponding to a region with amino acids MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM76A Blocking Peptide, catalog no. 33R-5601, is also available for use as a blocking control in assays to test for specificity of this FAM76A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM76A

Antigène: FAM76A (Family with Sequence Similarity 76, Member A (FAM76A))

Autre désignation: FAM76A (FAM76A Produits)

Synonymes: anticorps RGD1305162, anticorps family with sequence similarity 76 member A, anticorps family with sequence similarity 76, member A, anticorps FAM76A, anticorps Fam76a

Sujet: The specific function of FAM76A is not yet known.

Poids moléculaire: 35 kDa (MW of target protein)