NANP anticorps (Middle Region)

N° du produit ABIN632748

Cet anticorps anti-NANP est un anticorps Lapin Polyclonal détectant NANP dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour NANP anticorps (Middle Region) (ABIN632748)

Antigène: NANP (N-Acetylneuraminic Acid Phosphatase (NANP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NANP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NANP anticorps

Épitope: Middle Region

Specificité: NANP antibody was raised against the middle region of NANP

Purification: Affinity purified

Immunogène: NANP antibody was raised using the middle region of NANP corresponding to a region with amino acids VQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NANP Blocking Peptide, (ABIN5614910), is also available for use as a blocking control in assays to test for specificity of this NANP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NANP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium Azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NANP

Antigène: NANP (N-Acetylneuraminic Acid Phosphatase (NANP))

Autre désignation: NANP

Sujet: The function of NANP protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 28 kDa (MW of target protein)