PDIK1L anticorps (Middle Region)

N° du produit ABIN632750

L’anticorps Lapin Polyclonal anti-PDIK1L a été validé pour WB. Il convient pour détecter PDIK1L dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PDIK1L anticorps (Middle Region) (ABIN632750)

Antigène: PDIK1L (PDLIM1 Interacting Kinase 1 Like (PDIK1L))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDIK1L est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDIK1L anticorps

Épitope: Middle Region

Specificité: PDIK1 L antibody was raised against the middle region of PDIK1

Purification: Affinity purified

Immunogène: PDIK1 L antibody was raised using the middle region of PDIK1 corresponding to a region with amino acids FDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDIK1L Blocking Peptide, (ABIN938256), is also available for use as a blocking control in assays to test for specificity of this PDIK1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDIK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDIK1L

Antigène: PDIK1L (PDLIM1 Interacting Kinase 1 Like (PDIK1L))

Autre désignation: PDIK1L

Sujet: The specific function of PDIK1L is not yet known.

Poids moléculaire: 38 kDa (MW of target protein)