NADK2 anticorps (Middle Region)

N° du produit ABIN632753

L’anticorps Lapin Polyclonal anti-NADK2 a été validé pour WB. Il convient pour détecter NADK2 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour NADK2 anticorps (Middle Region) (ABIN632753)

Antigène: NADK2 (NAD Kinase 2, Mitochondrial (NADK2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NADK2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NADK2 anticorps

Épitope: Middle Region

Specificité: C5 ORF33 antibody was raised against the middle region of C5 rf33

Purification: Affinity purified

Immunogène: C5 ORF33 antibody was raised using the middle region of C5 rf33 corresponding to a region with amino acids RWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C5ORF33 Blocking Peptide, (ABIN5612525), is also available for use as a blocking control in assays to test for specificity of this C5ORF33 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NADK2

Antigène: NADK2 (NAD Kinase 2, Mitochondrial (NADK2))

Autre désignation: C5ORF33

Sujet: The specific function of C5orf33 is not yet known.

Poids moléculaire: 49 kDa (MW of target protein)