IQCK anticorps (Middle Region)

N° du produit ABIN632754

Détail du produit anti-IQCK anticorps

Antigène: IQCK (IQ Motif Containing K (IQCK))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IQCK est non-conjugé

Application: Western Blotting (WB)

Specificité: IQCK antibody was raised against the middle region of IQCK

Purification: Affinity purified

Immunogène: IQCK antibody was raised using the middle region of IQCK corresponding to a region with amino acids GMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IQCK Blocking Peptide, catalog no. 33R-3433, is also available for use as a blocking control in assays to test for specificity of this IQCK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IQCK

Antigène: IQCK (IQ Motif Containing K (IQCK))

Autre désignation: IQCK (IQCK Produits)

Synonymes: anticorps A230094G09Rik, anticorps IQ motif containing K, anticorps IQCK, anticorps Iqck

Sujet: The function of IQC protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 33 kDa (MW of target protein)