LACC1 anticorps (Middle Region)

N° du produit ABIN632755

Détail du produit anti-LACC1 anticorps

Antigène: LACC1 (C13orf31) (Chromosome 13 Open Reading Frame 31 (C13orf31))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LACC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: C13 ORF31 antibody was raised against the middle region of C13 rf31

Purification: Affinity purified

Immunogène: C13 ORF31 antibody was raised using the middle region of C13 rf31 corresponding to a region with amino acids TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C13ORF31 Blocking Peptide, catalog no. 33R-9117, is also available for use as a blocking control in assays to test for specificity of this C13ORF31 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LACC1

Antigène: LACC1 (C13orf31) (Chromosome 13 Open Reading Frame 31 (C13orf31))

Autre désignation: C13ORF31 (C13orf31 Produits)

Synonymes: anticorps C17H13orf31, anticorps c13orf31, anticorps C13orf31, anticorps 9030625A04Rik, anticorps laccase domain containing 1, anticorps laccase (multicopper oxidoreductase) domain containing 1 L homeolog, anticorps LACC1 laccase domain containing 1, anticorps laccase (multicopper oxidoreductase) domain containing 1, anticorps LACC1, anticorps lacc1.L, anticorps Lacc1

Sujet: The function of C13orf31 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 48 kDa (MW of target protein)