PSTK anticorps (Middle Region)

N° du produit ABIN632756

Détail du produit anti-PSTK anticorps

Antigène: PSTK (Phosphoseryl-tRNA Kinase (PSTK))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSTK est non-conjugé

Application: Western Blotting (WB)

Specificité: PSTK antibody was raised against the middle region of PSTK

Purification: Affinity purified

Immunogène: PSTK antibody was raised using the middle region of PSTK corresponding to a region with amino acids SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSTK Blocking Peptide, catalog no. 33R-8766, is also available for use as a blocking control in assays to test for specificity of this PSTK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSTK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSTK

Antigène: PSTK (Phosphoseryl-tRNA Kinase (PSTK))

Autre désignation: PSTK (PSTK Produits)

Synonymes: anticorps C10orf89, anticorps 5430423O14Rik, anticorps 5730458D16Rik, anticorps Gm1099, anticorps R75284, anticorps Pstk, anticorps phosphoseryl-tRNA kinase, anticorps phosphoseryl-tRNA kinase L homeolog, anticorps PSTK, anticorps pstk, anticorps pstk.L, anticorps Pstk

Sujet: PSTK specifically phosphorylates seryl-tRNA(Sec) to O-phosphoseryl-tRNA(Sec), an activated intermediate for selenocysteine biosynthesis.

Poids moléculaire: 39 kDa (MW of target protein)