FAM71A anticorps (C-Term)

N° du produit ABIN632763

Cet anticorps anti-FAM71A est un anticorps Lapin Polyclonal détectant FAM71A dans WB. Adapté pour Humain.

Aperçu rapide pour FAM71A anticorps (C-Term) (ABIN632763)

Antigène: FAM71A (Family with Sequence Similarity 71, Member A (FAM71A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM71A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM71A anticorps

Épitope: C-Term

Specificité: FAM71 A antibody was raised against the C terminal of FAM71

Purification: Affinity purified

Immunogène: FAM71 A antibody was raised using the C terminal of FAM71 corresponding to a region with amino acids DKIAQKSSSRSSFSHRANRDDKKEKGCGNPGSSRHRDSHKGVSHTPISKE

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM71A Blocking Peptide, (ABIN937405), is also available for use as a blocking control in assays to test for specificity of this FAM71A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM71A

Antigène: FAM71A (Family with Sequence Similarity 71, Member A (FAM71A))

Autre désignation: FAM71A

Sujet: FAM71A belongs to the FAM71 family. The exact function of C15orf27 remains unknown.

Poids moléculaire: 63 kDa (MW of target protein)