C19orf21 anticorps (C-Term)

N° du produit ABIN632766

Détail du produit anti-C19orf21 anticorps

Antigène: C19orf21 (MISP) (Mitotic Spindle Positioning (MISP))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C19orf21 est non-conjugé

Application: Western Blotting (WB)

Specificité: C19 ORF21 antibody was raised against the C terminal Of C19 rf21

Purification: Affinity purified

Immunogène: C19 ORF21 antibody was raised using the C terminal Of C19 rf21 corresponding to a region with amino acids RRNALFPEVFSPTPDENSDQNSRSSSQASGITGSYSVSESPFFSPIHLHS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C19ORF21 Blocking Peptide, catalog no. 33R-8150, is also available for use as a blocking control in assays to test for specificity of this C19ORF21 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C19orf21

Antigène: C19orf21 (MISP) (Mitotic Spindle Positioning (MISP))

Autre désignation: C19ORF21 (MISP Produits)

Synonymes: anticorps C19orf21, anticorps 9130017N09Rik, anticorps mitotic spindle positioning, anticorps MISP, anticorps Misp

Sujet: The function of C19orf21 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 75 kDa (MW of target protein)