DNAJC24 anticorps (N-Term)

N° du produit ABIN632772

Cet anticorps anti-DNAJC24 Polyclonal Lapin (ABIN632772) détecte spécifiquement DNAJC24 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour DNAJC24 anticorps (N-Term) (ABIN632772)

Antigène: DNAJC24 (DnaJ (Hsp40) Homolog, Subfamily C, Member 24 (DNAJC24))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNAJC24 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DNAJC24 anticorps

Épitope: N-Term

Specificité: DPH4 antibody was raised against the N terminal Of Dph4

Purification: Affinity purified

Immunogène: DPH4 antibody was raised using the N terminal Of Dph4 corresponding to a region with amino acids MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPH4 Blocking Peptide, (ABIN5613246), is also available for use as a blocking control in assays to test for specificity of this DPH4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNAJC24

Antigène: DNAJC24 (DnaJ (Hsp40) Homolog, Subfamily C, Member 24 (DNAJC24))

Autre désignation: DPH4

Sujet: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.

Poids moléculaire: 17 kDa (MW of target protein)