DNAJC24 anticorps (N-Term)

N° du produit ABIN632772

Détail du produit anti-DNAJC24 anticorps

Antigène: DNAJC24 (DnaJ (Hsp40) Homolog, Subfamily C, Member 24 (DNAJC24))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNAJC24 est non-conjugé

Application: Western Blotting (WB)

Specificité: DPH4 antibody was raised against the N terminal Of Dph4

Purification: Affinity purified

Immunogène: DPH4 antibody was raised using the N terminal Of Dph4 corresponding to a region with amino acids MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPH4 Blocking Peptide, catalog no. 33R-6225, is also available for use as a blocking control in assays to test for specificity of this DPH4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNAJC24

Antigène: DNAJC24 (DnaJ (Hsp40) Homolog, Subfamily C, Member 24 (DNAJC24))

Autre désignation: DPH4 (DNAJC24 Produits)

Synonymes: anticorps DPH4, anticorps JJJ3, anticorps ZCSL3, anticorps 1700030A21Rik, anticorps 2610027M02Rik, anticorps AV066965, anticorps AW240712, anticorps Dph4, anticorps MmDjC7, anticorps Zcsl3, anticorps RGD1564710, anticorps DnaJ heat shock protein family (Hsp40) member C24, anticorps DNAJC24, anticorps Dnajc24

Sujet: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.

Poids moléculaire: 17 kDa (MW of target protein)