OLFML2A anticorps (N-Term)

N° du produit ABIN632773

Détail du produit anti-OLFML2A anticorps

Antigène: OLFML2A (Olfactomedin-Like 2A (OLFML2A))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OLFML2A est non-conjugé

Application: Western Blotting (WB)

Specificité: OLFML2 A antibody was raised against the N terminal of OLFML2

Purification: Affinity purified

Immunogène: OLFML2 A antibody was raised using the N terminal of OLFML2 corresponding to a region with amino acids EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OLFML2A Blocking Peptide, catalog no. 33R-2311, is also available for use as a blocking control in assays to test for specificity of this OLFML2A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFML0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OLFML2A

Antigène: OLFML2A (Olfactomedin-Like 2A (OLFML2A))

Autre désignation: OLFML2A (OLFML2A Produits)

Synonymes: anticorps si:ch211-15b7.4, anticorps PRO34319, anticorps 4932431K08Rik, anticorps mFLJ00237, anticorps olfactomedin-like 2A, anticorps olfactomedin like 2A L homeolog, anticorps olfactomedin like 2A, anticorps olfml2a, anticorps olfml2a.L, anticorps OLFML2A, anticorps Olfml2a

Sujet: The exact function of OLFML2A is not known.

Poids moléculaire: 73 kDa (MW of target protein)