LRRC56 anticorps (N-Term)

N° du produit ABIN632776

Cet anticorps Lapin Polyclonal détecte spécifiquement LRRC56 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour LRRC56 anticorps (N-Term) (ABIN632776)

Antigène: LRRC56 (Leucine Rich Repeat Containing 56 (LRRC56))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC56 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LRRC56 anticorps

Épitope: N-Term

Specificité: LRRC56 antibody was raised against the N terminal of LRRC56

Purification: Affinity purified

Immunogène: LRRC56 antibody was raised using the N terminal of LRRC56 corresponding to a region with amino acids LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC56 Blocking Peptide, (ABIN940301), is also available for use as a blocking control in assays to test for specificity of this LRRC56 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC56 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC56

Antigène: LRRC56 (Leucine Rich Repeat Containing 56 (LRRC56))

Autre désignation: LRRC56

Sujet: LRRC56 contains 3 LRR (leucine-rich) repeats. The exact function of LRRC56 remains unknown.

Poids moléculaire: 59 kDa (MW of target protein)