GOLGA7B anticorps (N-Term)

N° du produit ABIN632779

Cet anticorps Lapin Polyclonal détecte spécifiquement GOLGA7B dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour GOLGA7B anticorps (N-Term) (ABIN632779)

Antigène: GOLGA7B (Golgin A7 Family, Member B (GOLGA7B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GOLGA7B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GOLGA7B anticorps

Épitope: N-Term

Specificité: C10 ORF132 antibody was raised against the N terminal Of C10 rf132

Purification: Affinity purified

Immunogène: C10 ORF132 antibody was raised using the N terminal Of C10 rf132 corresponding to a region with amino acids MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C10ORF132 Blocking Peptide, (ABIN5612380), is also available for use as a blocking control in assays to test for specificity of this C10ORF132 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF132 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GOLGA7B

Antigène: GOLGA7B (Golgin A7 Family, Member B (GOLGA7B))

Autre désignation: C10ORF132

Sujet: C10orf132 may be involved in protein transport from Golgi to cell surface (By similarity).

Poids moléculaire: 18 kDa (MW of target protein)